SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 214684.CND02870 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  214684.CND02870
Domain Number - Region: 95-118
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00586
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 214684.CND02870
Sequence length 574
Comment (Cryptococcus neoformans var JEC21)
Sequence
MLSTSTSLQGGKVSREEYRRQKDLEAARKAGTAPAALDEQGNAINPHIPEYITKAPWYAD
TGRPSLAHQRINEQGPHLKLDEWYDRGAKAGPAAKKYRKGACENCGAMTHKMKDCVERPR
KRGAKFTNKDIAPDELVQQFEGDYDAKRDRWNGYDPASYKHVVEEYEATEQMRKKYREEE
IDQQTSTDMAVVKKLAKKDKEGKVEDDDDDFGSSDEDEDDEDKYADAADQVGQKLDTKTR
ITVRNLRIREDTAKYLINLDESSAYYDPKTRSMRDAPVRNMNPEDMKFAGDNFQRYSGDA
TNMQKLQLFAWQSAQKGSNINVSANPTAGELLHREFQQKKEVLKDTNKTSILAKYGGEEH
LQRMPNELLSGQTENYVEYSRSGQIIKGRERAKARSKYDEDVYINNHTAIWGSYYDLSTS
QWGFACCHSVLPGSYCTGDAGKLANAASSASALLASSNERSKIEEAAEKERESLAEQHLK
DLASGKAKKGKEREWDLPQYAKRREDGEELDLDKGRLKNALKEEKKRKKMGEDEAWQQTK
KGKTDVTQEELEAYRLSRQAYDDPMSNYQDPEDQ
Download sequence
Identical sequences P0CR52 P0CR53
214684.CND02870 163.m06198 sgtc|cn04355 XP_570464.1.95466 XP_775942.1.65578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]