SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 214684.CND03400 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  214684.CND03400
Domain Number 1 Region: 316-380
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000825
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 2 Region: 221-242
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000602
Family Retrovirus zinc finger-like domains 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 214684.CND03400
Sequence length 598
Comment (Cryptococcus neoformans var JEC21)
Sequence
MSTVFYRWGAGRDESRVTFDGTHISVFDLKREIILNNKMGNGKDFDLSIYDNVTGEELKD
DNQQIPRSSSLVARRLPPSLGKGRGSAADYIAGTTAAEALTGDHRVESHARQAMLDKNLT
KGIRSAGGTYGSLSKRFDGKEEKPAEKVQVSTGDKDEDAKIQAILAQGAETWEQMQEDMS
AGYRAPAARAARANKPSGSAVAGASQKYDFSLGPEKEPPVGYICYRCGQKGHWIQNCPEN
DDPAAAERKRFVRVTGIPRSFLKTVETPVGAEGSSGGAMLTADGGFVKAVPDQRQWQKQA
AVKPRALTGADVRDQEPLEADLTCPLCKKLVWEAVRTPCCNTAFCEECVQTYLVDHDFEC
PHCESKVPSLDRLKPDEDLRKRSRNYVDHELQKNKDAKGDSADGDVKEEAENDKNADDSE
EGSLTPKEQNKNQILGADGQPLNSDLLDPHMIQNYLFGAKKMLLNPDLNPAARALLTTQM
QTLQANLLQMQMMAMMNGMGMGVGLPLMGGQNNVGGGQTGIGLNGAIDNSMAMRGRPGFR
GGFRGRGMATGQGFQRGPLGPAAQGGMGMGMMNRPNVPAKRGADVELGGEAKQPRTGV
Download sequence
Identical sequences F5HC56 Q5KID1
XP_570171.1.95466 XP_775887.1.65578 163.m06283 sgtc|cn04300 214684.CND03400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]