SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 216594.MMAR_3122 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  216594.MMAR_3122
Domain Number 1 Region: 16-173
Classification Level Classification E-value
Superfamily PEBP-like 2.75e-48
Family Prokaryotic PEBP-like proteins 0.0000649
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 216594.MMAR_3122
Sequence length 175
Comment (Mycobacterium marinum M)
Sequence
MTSPDPYDALPKLPSFSLTSASITDGQPLATPQVSGIMGAGGEDVSPQLSWSGFPEGTRS
FAVTVYDPDAPTLSGFWHWAVANLPADVTELPAGAGDGRELPGGALALVNDAGMRRYIGA
APPAGHGVHRYYVAVHAVDVDKLELSEDASPAFLGFNLFQHAIARAVIHGTYEQT
Download sequence
Identical sequences A0A1B4Y3T9 A0PQW7 B2HFZ3 L7V9D8
gi|443491443|ref|YP_007369590.1| 216594.MMAR_3122 362242.MUL_2372 WP_011740352.1.20315 WP_011740352.1.28311 WP_011740352.1.33562 WP_011740352.1.39490 WP_011740352.1.48473 WP_011740352.1.5386 WP_011740352.1.90902 WP_011740352.1.91103 WP_011740352.1.92715 gi|118617875|ref|YP_906207.1| gi|183983121|ref|YP_001851412.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]