SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 216895.VV1_0543 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  216895.VV1_0543
Domain Number 1 Region: 1-424
Classification Level Classification E-value
Superfamily Tryptophan synthase beta subunit-like PLP-dependent enzymes 6.16e-132
Family Tryptophan synthase beta subunit-like PLP-dependent enzymes 0.0000000000497
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 216895.VV1_0543
Sequence length 426
Comment (Vibrio vulnificus CMCP6)
Sequence
MKLYNIKENDEQVSFGQAVRQGLGRNQGLFFPAELPKFDDIDALLAQDFISRSTAILSAL
IGDELAEDKVNSMVDAAFQFPAPIKQVKEGVYALELFHGPTLAFKDFGGRFMAQSLAAVS
DGGKITILTATSGDTGAAVAHAFYGMEDINVVILYPKGKISPLQEKLFCTLGKNIHTVAI
NGDFDACQALVKQAFDDAELREEIGLNSANSINISRLMAQICYYFEAAAQMSKQERENLV
VSVPSGNFGNLTAGLLAKALGLPIKRFIAATNANDTVPRYLETGKWDPKPTVATTSNAMD
VSQPNNWPRIEELCRVKEWGLETLGKGAVSDEQSAQSVKDLYSLGYLCEPHGAIAYRVLD
QQLQEGETGLFLCTAHPAKFKEVVDDILGSDIDLPAPLAKHAVMELLSEELDADFTALKE
VLRRVQ
Download sequence
Identical sequences A0A087JAN8 A0A1L9KYW6 Q7MNR3
196600.VV0652 216895.VV1_0543 gi|37678836|ref|NP_933445.1| gi|320157386|ref|YP_004189765.1| gi|27364005|ref|NP_759533.1| WP_011078630.1.100126 WP_011078630.1.17874 WP_011078630.1.21633 WP_011078630.1.22778 WP_011078630.1.24453 WP_011078630.1.25536 WP_011078630.1.34622 WP_011078630.1.39524 WP_011078630.1.53345 WP_011078630.1.54858 WP_011078630.1.55006 WP_011078630.1.59022 WP_011078630.1.73066 WP_011078630.1.78369 WP_011078630.1.82587 WP_011078630.1.8292 WP_011078630.1.8379 WP_011078630.1.84562 WP_011078630.1.89979 WP_011078630.1.90288 WP_011078630.1.93668 WP_011078630.1.94371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]