SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 216895.VV2_0861 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  216895.VV2_0861
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily PTS system IIB component-like 2.17e-22
Family PTS system, Lactose/Cellobiose specific IIB subunit 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 216895.VV2_0861
Sequence length 96
Comment (Vibrio vulnificus CMCP6)
Sequence
MMKIMVVCGHGLGTSLMMEMSIKAIVKDLNVDAAVDHIDLGSAKGTDCDIFIGTNDITEQ
LKNLGVEPKIVSLDNMVDKVAMKDRLSIALQELGAL
Download sequence
Identical sequences A0A1W6MBV8 Q7MCQ4
gi|37676992|ref|NP_937388.1| 196600.VVA1332 216895.VV2_0861 gi|320159076|ref|YP_004191454.1| gi|27367267|ref|NP_762794.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]