SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 218491.ECA4185 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  218491.ECA4185
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 7.32e-39
Family Frataxin-like 0.00000613
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 218491.ECA4185
Sequence length 106
Comment (Erwinia carotovora atroseptica SCRI1043)
Sequence
MNDSEFHQLADELMLQLEETLDQFEGDADIDSEINGGVMTLSFENGSKIVINRQEPLHQI
WLATKTGGYHFTLREERWVCDRSGEDFIALLSSACSAQAGETVHFE
Download sequence
Identical sequences Q6CZG6
218491.ECA4185 gi|50123105|ref|YP_052272.1| WP_011095656.1.17763 WP_011095656.1.57850 WP_011095656.1.79946 WP_011095656.1.94180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]