SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 224324.aq_1429 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  224324.aq_1429
Domain Number 1 Region: 1-288
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 3.14e-108
Family Methylenetetrahydrofolate reductase 0.0000000725
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 224324.aq_1429
Sequence length 296
Comment (Aquifex aeolicus)
Sequence
MKIGDILRKGVFSISFEFFPPKTEEGERQLFETIRKLEKLNPTFVSVTYGAGGSTRDRTR
NIVQKIHEETNLTVMAHLTCIAHTREELIDILQDYKNIGIENILALRGDVPRDKPDWRPP
KGACKYAKELVELIRKEFGDWFSIGVASYPEGHPESPNLEWEVKYFKEKVEAGADFSITQ
MFFVNDYYYRFVEMCKNAGIDISIIPGIMPITNFKQIRKFASLCGATIPQSLIEKLEKVE
DKPEEVKKIGIEFAINQCLDLIEHGVPGLHFYTLNKSDATLKIYEAIKDKIPARST
Download sequence
Identical sequences O67422
224324.aq_1429 gi|15606607|ref|NP_213987.1| NP_213987.1.100253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]