SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 234267.Acid_3560 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  234267.Acid_3560
Domain Number 1 Region: 99-349
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.04e-44
Family Purple acid phosphatase-like 0.0041
Further Details:      
 
Weak hits

Sequence:  234267.Acid_3560
Domain Number - Region: 18-88
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0111
Family Fibronectin type III 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 234267.Acid_3560
Sequence length 355
Comment (Solibacter usitatus Ellin6076)
Sequence
MNPIRVLCLIAAAVPLLYSAPKIVGGPFAVNVTSRGATVMWIVETEELSVRPVGEAAKIS
PSLHAEKTDLANLQPNTRYEYEVAGLKGSFKTAPNGAEPFTFIAYGDVRTRHDVHRRVIA
KILETGVPDLILQSGDLVENGHDSSQWPTFFDIERELLRQTAFFPSLGNHERASKDFYEF
FQNETGFYSFNWGNAHFAVINSDINSISTSKSLRDEFWERQKRWLEDDLAGAQKADYRFV
MAHHPPYTAVERRQGDNPHVTALVPMFEKYKVTAGIFGHDHNYQHYLKNGVHYIVTGGGG
APLYDVNKPDPAITQKVVSIENFVTVSVNGKVAKVKAISIDGKILDEFEFQSPVK
Download sequence
Identical sequences Q020V7
234267.Acid_3560 gi|116622661|ref|YP_824817.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]