SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 234267.Acid_5052 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  234267.Acid_5052
Domain Number 1 Region: 125-385
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 8.65e-52
Family D-glucarate dehydratase-like 0.0011
Further Details:      
 
Domain Number 2 Region: 31-141
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.22e-24
Family Enolase N-terminal domain-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 234267.Acid_5052
Sequence length 412
Comment (Solibacter usitatus Ellin6076)
Sequence
MNRRTLLRSAAAAAGLSLAGRDAARAAIPKMKVTRVRVYSPPNPNPLFNQSDMVVTVETD
AGITGIGEGGSRDTLEQCAGRLIGQDPRYIERLWQDMARSFFYPPGREKIHALGALDLAL
WDIQGKVLGRPVHALLGGMARNFCECYPTAGVIPGVRGGMPIKEHAQAVMAAGYRAFRMG
AADTPANGTFNTHERLNKMAEDCAQAREGVGKNGDWCIDFHQRFDLSEAIRGCDLIKDFA
PYFVEDPVRTEAFLEDIPLLRRSAKVPIAAGEEWGYRWDFNKLVEGHDIDYIRATLPNVG
GITEMMKIAAICETHFVGIIPHFTGPIATAALVHALGVFSGPVLVEFTYQGIVKPYLPVW
LDFREGKLYPNDRPGLGVELDLKPLKLVSEITERVTARAQVYYRPDGSITNW
Download sequence
Identical sequences Q01WF8
gi|116624136|ref|YP_826292.1| NYSGXRC-9849a WP_011686757.1.46729 234267.Acid_5052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]