SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 235909.GK0620 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  235909.GK0620
Domain Number 1 Region: 5-225
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.04e-48
Family ABC transporter ATPase domain-like 0.00042
Further Details:      
 
Domain Number 2 Region: 278-466
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.24e-44
Family ABC transporter ATPase domain-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 235909.GK0620
Sequence length 483
Comment (Geobacillus kaustophilus HTA426)
Sequence
MKQAIAIDRLRLKFPGSDGLLFRDLSLSIAEGEKVLLLGPSGCGKSTLLQVMAGIIPRSI
DVPMKAERLKRPERWGYVFQDPDAQFCMPYADEEIAFALENRSVPRHEMPVRIRALLNQV
GLEIAPHTDIHTLSGGMKQRLALASVLALEPDVLFLDEPTALLDEEGTKAVWQTVKQVGR
GKTVIIVEHKIDHVLDFVDRIVLFGRDGRIIADGEAKAVFSDYKDVIAAEGIWYPGVWDD
YDRTARRRNRHRGEELLRLARFRGFRGREAKIYVPEATVHAGEWIAVTGKNGAGKSTLLH
ALMQLIRTDGEYMLLGADIKRQHPLYRHIAFVFQNPEWQFVAHSVREELAYSLRLEGRPK
EEIEGIVDRLLREFDLVEQQDQHPYQLSVGQKRRLSVAASIVAGQRLFLLDEPTFGQDAK
NTFALLEMLEAYREQGAAIMMVTHDEQIVRRFATRQWVIEDGALVRDERLDIREPVLAEG
GAG
Download sequence
Identical sequences A0A1C3D652 A0A1V9BZL6 Q5L2C5 T0NRC3
235909.GK0620 gi|56419155|ref|YP_146473.1| WP_011230124.1.100150 WP_011230124.1.2219 WP_011230124.1.22479 WP_011230124.1.45808 WP_011230124.1.60903 WP_011230124.1.70239 WP_011230124.1.78869 WP_011230124.1.8599 WP_011230124.1.90668 WP_011230124.1.91533 WP_011230124.1.93593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]