SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 235909.GK0781 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  235909.GK0781
Domain Number 1 Region: 29-263
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.3e-26
Family Extended AAA-ATPase domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 235909.GK0781
Sequence length 266
Comment (Geobacillus kaustophilus HTA426)
Sequence
MYKSFYSLSREPFAKETDPSEAYQGAPFQEALRALEYVKRTRGIGLLIGEPGAGKTFALR
ALKESLNPSLYHVVYFPLSTGGVMDFYRGLALGLGEEPKYRKVDLFRQIQQAIERLYHER
RITPVFILDEMHLAKDAFLQDIAILFNFEMDSTNPFVLILAGLPHLQGKLRLNQHHPLDQ
RIIMRYRMGPLEREEVAGYIEHRMKQAGAKHPIFTPSALEAIALQSRGWPRVINTLATTC
LLYGYQLKKDAIDEEVVRMAAEEMGY
Download sequence
Identical sequences A0A0K1K7C2 A0A2H5KG42 G5EAS3 L7ZX77 Q5L1W4
gi|448237948|ref|YP_007402006.1| 235909.GK0781 235909.GK1917 WP_011230283.1.17728 WP_011230283.1.2219 gi|56419316|ref|YP_146634.1| gi|56420452|ref|YP_147770.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]