SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 235909.GK1142 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  235909.GK1142
Domain Number 1 Region: 3-223
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2e-56
Family ABC transporter ATPase domain-like 0.0000748
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 235909.GK1142
Sequence length 288
Comment (Geobacillus kaustophilus HTA426)
Sequence
MAVVIEGLTKIVKKKPILSDVSLTLSGVYGLLGPNGAGKTTLMRIVAGLLEFNAGQVLLG
EERISTGTRVKRVNEIGYLPQEFMMYPELTMYEVLEHLAVLQGEHPAACRSKIEKVIEQV
NLSSHINKKMRELSGGMRRRVGIAMLLLREPSILLFDEPTAGLDIRERVRFRNLLKRLGH
DHTIVISSHLVEDIEFLCTKIGVLDRGTVLFEGSPDELKQKAAPYTYELEVPFAELDSIM
ATNEVVQMSEEPSHVVVRVLSEEPIGRRVAPRLMDGYLALLKEAEAHG
Download sequence
Identical sequences A0A063YUM0 A0A0Q0UK98 A0A1V9BXU9 A0A2H5KLE2 Q5L0V3
gi|56419677|ref|YP_146995.1| 235909.GK1142 WP_011230642.1.10946 WP_011230642.1.19233 WP_011230642.1.2219 WP_011230642.1.38928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]