SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 235909.GK1663 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  235909.GK1663
Domain Number 1 Region: 1-232
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.44e-62
Family ABC transporter ATPase domain-like 0.00000283
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 235909.GK1663
Sequence length 235
Comment (Geobacillus kaustophilus HTA426)
Sequence
MLEVANVSVRYGSFTAIRDVTFSVKRGEIAVLLGANGAGKSTLFRTISGLHKPVQGEIRL
DGERIDSLPPDRIVGRGVVQCAEGRKLFPRMSVYENLLMGAYVHRKDKEGIRRSIEHVYE
LFPILRDKQNAPAGSLSGGQQQMLAIGRALMSRPAVLLLDEPSIGLAPLIVEQMFATIKQ
INEGGTTILLAEQNAHAALSIAHQGYVFENGTIVASGTAEELLANDDVRKAYIGA
Download sequence
Identical sequences A0A1V9BUJ9 Q5KZD8
WP_011231158.1.2219 WP_011231158.1.70239 235909.GK1663 gi|56420198|ref|YP_147516.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]