SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 235909.GK1894 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  235909.GK1894
Domain Number 1 Region: 5-233
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.28e-56
Family ABC transporter ATPase domain-like 0.00011
Further Details:      
 
Domain Number 2 Region: 262-487
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.22e-49
Family ABC transporter ATPase domain-like 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 235909.GK1894
Sequence length 503
Comment (Geobacillus kaustophilus HTA426)
Sequence
MSEDYVLEMIDITKEFPGVKALDGVQLKVKRGTVHALMGENGAGKSTLMKILIGIYTPDR
GKIILDGEELKVSTIKHALDRGISMIHQELSPVPNMTVAENIFLGREPSYPFAGWVKMKE
LVKKTRQLFERLEIDIDPNAKMADLSIANMQMVEIAKAISYHSKLIIMDEPTSAITEKEV
HHLFRIIRSLKKEGVSIIYITHKMDELEQITDEVTVLRDGKYIGTKPSHQMTRDELIQMM
VGRELNQIFHKPKVPIGEVALSVQGLTKKGKFHDVSFEVRKGEIVGFAGLMGSGRTEVLE
SVFGVTKPDAGDIYVHGKKATIRSTRDAIRYGMGLLTEDRKLTGLFLPLSVEDNMITVTV
NQYTKAGFLQQRKIREDCQRLAEQLSIKTPSLQQLIKYLSGGNQQKALIARWLLHNPDIL
FLDEPTRGIDVGAKAEIYHLIFELAKNGKAIIVVSSEMPEILGLSDRVIVMHEGRKMGEL
TREEATQERIMQLATGQLIETKR
Download sequence
Identical sequences A0A1Q5SPG6 Q5KYQ7
235909.GK1894 WP_011231384.1.2219 WP_011231384.1.77642 gi|56420429|ref|YP_147747.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]