SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 235909.GK2176 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  235909.GK2176
Domain Number 1 Region: 3-180
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.73e-53
Family DnaQ-like 3'-5' exonuclease 0.002
Further Details:      
 
Domain Number 2 Region: 270-324,406-476,651-665,699-870
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.59e-25
Family Tandem AAA-ATPase domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 235909.GK2176
Sequence length 909
Comment (Geobacillus kaustophilus HTA426)
Sequence
MATRFVIIDLETTGNGPKKGDRIIQLGMAVVEDGLIVERFASFFNPEQPIPLFIQQLTNI
NEEMVEGAPLFADKAGEIAALMHGAYFVAHNVDFDLPFLQAELERAGWPPFSGPTIDTVE
LARIVLPTAESYKLGDLARQLGLHHNRPHQADSDAEVTAKLFIALLKRLSRLPLMTLEQL
RGLARHLKSDIYLLLDAVIAKKRNKAPADRAVAVYRGIALKQPAPEPDESDRRPALASFA
AFCEQEPPLPLPGYKRRAGQWEMMRLVYEALSTSQHALIEAGTGLGKSLAYLIPAAFFAC
EQQERVVISTHTLQLQEQLIRRDWPVLRQIAPFPLRVAVLKGKQNYLSLDKFASFLSEPS
DTYDAALLKCQVLVWLLETDSGDLDELNVSSGARLLLSALAIGEEEDGGRHHFFARAKER
SERADVVITNHALLLHDLTGPAPLLPPFRHLIIDEAHRLEDAAARCFGEQISYVSFRLLT
AKIAQTIAKWQEAEQDAPNGALVRCQQRLEELQFEGDELFRLLRRYALDKKPARAGRCRY
RFSPTDEQSRAWQAAVELCWRLRDLAAALSAEAKPLLSADTSGDFPPSALLSADLAALNR
QMAALVRLLTEKEPGVVRWIEADEKGAANAVRLYSQPVDLADFFADQLFMKKRSVVLTSA
TLTVRGRFTYMAARLGLEDFYPLCRSFPSPFRYEEQAALFVPADMPLVSAVPLEDYAEAV
AASVLAIARRLGRRVLVLFPSYELLKLTVDALKTEEEGEPFVLIAQGVQSGSPAKLLRTF
LQFEHAVLFGTSSFWEGVDLPGSALDVLVIARLPFAPPDDPVMEAKSERIRLEGGDPFSE
LALPEAVLRFKQGFGRLIRTEDDKGAVFVLDRRLLASPYGADFLASLPPLSVHEGALSEL
LDKAETWLS
Download sequence
Identical sequences Q5KXX5
gi|56420711|ref|YP_148029.1| 235909.GK2176 WP_011231661.1.2219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]