SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 235909.GK2721 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  235909.GK2721
Domain Number 1 Region: 127-273
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.93e-20
Family Extended AAA-ATPase domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 235909.GK2721
Sequence length 313
Comment (Geobacillus kaustophilus HTA426)
Sequence
MERVNHLLQRLLGNQRFKQRYEQMKRYILEHPDVQPFLRAHERQLSADAVDRSLMKLYEF
IEQHGNCRQCPGLERCNNMLPGYHPNLVVNGGRIDVEYDRCPKKVQHDERKRQESLIQSM
FMPREILRASLSDVDLNDDGRIKAIRFAERFVAEYEPGKKMKGLYLHGSFGVGKTYLLAA
IANELAKRNVSSLIVYVPELFRELKHSLQDQTMNEKLDYIKKVPVLMLDDLGAEAMSSWV
RDDVFGPILQYRMFENLPTFFTSNFDMQQLAHHLTYSQRGEEEKVKAARIMERIRYLAYP
IEITGPNRREQNI
Download sequence
Identical sequences Q5KWD0
gi|56421256|ref|YP_148574.1| WP_011232195.1.2219 235909.GK2721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]