SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 235909.GK3262 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  235909.GK3262
Domain Number 1 Region: 661-912
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.99e-66
Family Tandem AAA-ATPase domain 0.00000139
Further Details:      
 
Domain Number 2 Region: 400-658
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.43e-59
Family Tandem AAA-ATPase domain 0.00000211
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 235909.GK3262
Sequence length 919
Comment (Geobacillus kaustophilus HTA426)
Sequence
MKALETIQISCRWNEEIRCFELSGSTHPSSWVSPLLAWHEETFYGTMIDIEDDIVRLSPW
QALTLFALRPHSRFSAIEWADEFTARLEEWAKHIWNGLRERRFLPDASLWKSTGGAWSEA
GRTRWRGADDDPDPFVATWRSLAVADWLSRDPELRGIWGEIVRTYPLIASPSGQWTGTED
DWLEQIGWLGDRPPFVVGLRLVEPSEEGDVWTLEAVLIAVDDSVIAPASDIPRAWRPYES
SIQRAIRRICAIVPWLDAGEGLRTELSNEEAWRFLSEDSLKLTEAGVRLLLPDWWHDIRQ
AQLSIKAKLSPSVNAESLFGLERLADFDWRVATNGIELTEEEFAALAEQKRRLIRLRGQW
LILDPALVRRAQALMEKAKKEGVPIHDIVAQTLLSEAEEREEAADESIPIHIDVHDQFRA
FIRQLQQLDGLPKANVPPSFHGTLRPYQQRGVDWLVFLRRFGFGACLADDMGLGKTVQLL
AYLAHVKEIERPDTPALLICPTSVIGNWQKECARFTPDLRVYVHHGPNRAKNDAFVQTAG
EADLVITSYNLAHLDQDDLKQIHWHAICLDEAQNIKNAQTKQARAIRRLSGKHKIALSGT
PVENRLGELWSIFHFLNPGYLGSAAEFERRFAGPIEKEGDARKKAALQTLIRPFLLRRTK
TDEAVALNLPDKLEQKEYCPLTAEQAALYEQLVNDTLERAKEASPFARRGLILQMLNGVK
QICDHPALYLKERRPRQLVERSHKLEKLIELIEQIRANDESCLIFTQYVRMGEMIQELLS
DLFDERVLFLHGGVPKQTRDRMVDEFQAKKAPIFLLSLKAGGTGLNLTAANHVIHFDRWW
NPAVENQATDRAYRIGQTKFVHVHKLITTGTIEEKIDEMLEQKQALADVITEGEAWITEL
SDDELRDLLALSAAAKGGA
Download sequence
Identical sequences Q5KUT9
gi|56421797|ref|YP_149115.1| 235909.GK3262 WP_011232732.1.2219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]