SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 240015.ACP_0387 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  240015.ACP_0387
Domain Number 1 Region: 282-511
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.82e-34
Family mu transposase, core domain 0.042
Further Details:      
 
Weak hits

Sequence:  240015.ACP_0387
Domain Number - Region: 160-248
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00358
Family Recombinase DNA-binding domain 0.012
Further Details:      
 
Domain Number - Region: 17-74
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0336
Family Excisionase-like 0.022
Further Details:      
 
Domain Number - Region: 532-596
Classification Level Classification E-value
Superfamily mu transposase, C-terminal domain 0.0863
Family mu transposase, C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 240015.ACP_0387
Sequence length 697
Comment (Acidobacterium capsulatum ATCC 51196)
Sequence
MSAAPKLYLVPQAAAHEWLTAEEAIARTGLTDRWLREQARHGSIISRATGRTGRNGKPLR
EYLASSLPASERRVAEACSNAASAMRSLPLFTDSQVALPAKAAPDTLPVGAAAQRQAEER
WAVLQPIVDFDKDPLRYAALRLKDGSQVTSQTRMLEYQAEISGVYSRTLKRWLKRWRDGG
LAALADRNRQDKGLSRWFEEHPEAKDVTAAAYLQPEQSKIAAYEALQRWCSRAGILAPHY
STVRRWLDSDDLPEPVVTLAREGERALKERHLPFLRKAYTDIAPNQIWVSDHMIHDVLVR
NDCFEGAAPNAAIRLRFTAMIDYRSRKPMGYCWTVEGSSRSIALALRRGIERYGAPSTLY
VDNGKDYKRVARGAAPVWKRVASEQFVADVAWVESLGVLSRLGIEVQHCLKYHPQSKHIE
RFFRTLHMRLDRVIAGYTTGNAYRRPGATNALAVAHQRAIKSGHAEASPLLRASELIQLG
TAWLETEYSVAPHRGRGMDGRSPNEVYDGGYPVESRHIPDLSNLDHLFWARAQRKLDSGN
IRLANEFYGPAVGDEVGSANLFTHGSNDVFVHYDENEIAPETAIVTDLDGRVLARVHRVQ
LQPHSAAAQPYIAASMAERMRLKKAARETVRTIRKRADQAGYVPAIDVLRERTQLPAATQ
QHINDRPTARKPKAGQNTVAPPSAVDIATDFLEALSE
Download sequence
Identical sequences C1FA08
WP_012680784.1.62785 240015.ACP_0387 gi|225872072|ref|YP_002753527.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]