SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 240015.ACP_1225 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  240015.ACP_1225
Domain Number 1 Region: 4-130
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 8.42e-35
Family DNA-binding N-terminal domain of transcription activators 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 240015.ACP_1225
Sequence length 136
Comment (Acidobacterium capsulatum ATCC 51196)
Sequence
MERLTISQVAKRSGVNIQTIRYYERQGLLSARSRTAAAYRIFSVESVQRIRFIKRAQELG
FSLKEIKELLSLRMDTHTTQADIRKQAQTKIADVERKILHLEAIRASLLRMAENCSGCGS
LKDCPILESLDKEDPE
Download sequence
Identical sequences C1F4V3
gi|225872865|ref|YP_002754322.1| 240015.ACP_1225 WP_015896374.1.62785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]