SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 240015.ACP_1830 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  240015.ACP_1830
Domain Number 1 Region: 88-273
Classification Level Classification E-value
Superfamily PheT/TilS domain 6.02e-61
Family B3/B4 domain of PheRS, PheT 0.0000127
Further Details:      
 
Domain Number 2 Region: 363-582
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.83e-35
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0003
Further Details:      
 
Domain Number 3 Region: 591-687
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 6.67e-17
Family Anticodon-binding domain of PheRS 0.0016
Further Details:      
 
Domain Number 4 Region: 296-371
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000165
Family Domains B1 and B5 of PheRS-beta, PheT 0.0023
Further Details:      
 
Domain Number 5 Region: 1-77
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.000000000897
Family Domains B1 and B5 of PheRS-beta, PheT 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 240015.ACP_1830
Sequence length 688
Comment (Acidobacterium capsulatum ATCC 51196)
Sequence
MRILTQWLRDYVALPSISDAELADALTLRGIAVDGVFDLGAHGSVFEMDVTTNRVDAMNH
YGVAREASIIFGCALKPLDGSLPAPKPGSAFPVRIEEPTLCGRFTARVLRGVTIQPSHGI
VAERFAALEQKLISNAVDATNFVTLGMGHPTHAFDLDKLEGGIVVRRARKGEKLVTLDGV
ERTLDPDDLVVADEKKAVGLAGVMGGLDTAISASTKNILVEAAWFDQNTVRRSSRRHGIH
TDASHRFERGADFNAPPLANALVSRIILEAGGHIEGELVDVLIPEAEARTAKRAAVSFAV
PEIARILGATEDPQGITAADAEGILTGLGCTLEKSGEQSYSVTLPSWRLDLEREIDLLEE
IARVYGYNRFQNTLPTFAGSVVELPWAAKEATLRGKLLGLGWNEAISSTFCAEADALAFC
REPNSAVAVGNPLSEEAGMLRPSLLPGMLTMLANNLSRDVESVALFEIGTVFTGSTEKVD
ERPALAIGATGRPFGAGEVDFYDLKGTLQELLHSFTARSLYFDRFPAESGLMPAWLHPGR
SARAVIDGATVGYFGQLHPAEAERRKVKQTVLVGELYLDRLYKQSLRTPVIEELSRYQAV
RRDFSFLVPDAVSWGQLAEAIVALPIPELRSFAPREILRGERVAAGHYSLLLGTVFQSHE
RTLRDEDLQAWAQQVIAAMQDRGAQLRS
Download sequence
Identical sequences C1F7U8
WP_015896950.1.62785 240015.ACP_1830 gi|225873445|ref|YP_002754904.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]