SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 240015.ACP_2861 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  240015.ACP_2861
Domain Number 1 Region: 5-225
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.3e-57
Family LplA-like 0.00000726
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 240015.ACP_2861
Sequence length 246
Comment (Acidobacterium capsulatum ATCC 51196)
Sequence
MVLNLLHLGRIGYAQGLELQRQLVEARHSGRIGNTLLLLEHPPVLTLGRNSERKNVLASD
EFLAYRGVEIHEVNRGGDVTYHGPGQLVGYPILDLRSFAESGERGRLGAVEYVRWVEEAL
IRTCADFGVQTQRVAGRTGVWTLPGGSVEEKKIAAIGVHISRGITSHGFALNVTTDLRDF
DLIVPCGISDRKVTSLELEVIDEPALTMEKVIHSAARQFGRVFGHQVLWLESPGDLLPEL
ATLTQS
Download sequence
Identical sequences C1F3S1
240015.ACP_2861 WP_015897917.1.62785 gi|225874417|ref|YP_002755876.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]