SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 240292.Ava_1380 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  240292.Ava_1380
Domain Number - Region: 171-214
Classification Level Classification E-value
Superfamily Argininosuccinate synthetase, C-terminal domain 0.011
Family Argininosuccinate synthetase, C-terminal domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 240292.Ava_1380
Sequence length 313
Comment (Anabaena variabilis ATCC 29413)
Sequence
MRYSIREQMRLIALALGVATLLSLFFSTFLPDYIHKAPELAGMWSGIYGHKNELGYMMAW
SAGIFLHLALSNYQYTWLMWTLCGVATSLIILSRSTTSLTILLTIILILPFYRFFKKTNY
KLQVIMIGLALILLTLSTILLMTNIENIVGTSGKDLTFNGRADLWEPIISKVWERPWFGY
GYYGFWNSPEAANVRATYEWASNSHNGFLELLLDIGFLGFLVFAAGFIRFFVLALGRIIS
VAKKPEDYWPMQMLIIIVIVNFSEARLLTPSWNWLMYITTSLSLSLSYQRIRMGIKEDLK
AEFMSSNRITVRE
Download sequence
Identical sequences Q3MDD2
gi|75907603|ref|YP_321899.1| 240292.Ava_1380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]