SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 240292.Ava_4890 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  240292.Ava_4890
Domain Number 1 Region: 20-502
Classification Level Classification E-value
Superfamily ADC synthase 2.22e-130
Family ADC synthase 0.00000156
Further Details:      
 
Domain Number 2 Region: 525-717
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 4.95e-44
Family Class I glutamine amidotransferases (GAT) 0.0000862
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 240292.Ava_4890
Sequence length 728
Comment (Anabaena variabilis ATCC 29413)
Sequence
MNYYTLAYTTLGNVRVSRSTTEVKMDTALDEILFHLNQVRGGLLTSSYEYPGRYKRWAIG
FINPPLQLTTRENAFTISSLNPRGQVLLPTLFQHLSAQSQLQQISLNHDYITGEIRPTKQ
LFTEEQRSKQPSAFTVIREILQIFASDEDEHLGLYGAFGYDLVFQFEPIPQKIARPADQR
DLVLYLPDELIVVDYYLQKAYRHQYEFATEHGNTEHLPRTGQSIDYQGKRLLPNQTADHQ
PGEYANLVEQALDYFRRGDLFEVVPSQNFFTACEQSPSQLFQTLRQINPSPYGFLLNLGG
EYLIGASPEMFVRVDGRRVETCPISGTIRRGEDALGDAVQIRQLLNSHKDEAELTMCTDV
DRNDKSRICEPGSVRVIGRRQIELYSHLIHTVDHVEGILRPEFDALDAFLSHTWAVTVTG
APKRAAMQFIEQHERSARRWYGGAVGYLGFNGNLNTGLTLRTIRLQDSIAEVRVGATVLY
DSVPSAEEEETITKATALFETIRRHTTANKTKGSDSHRPGDIVKNKRILLIDYEDSFVHT
LANYIRTTGATVTTLRHGFAESYFDTERPDLVVLSPGPGRPSDFRVPQTVAALVGREIPI
FGVCLGLQGIVEAFGGELGVLDYPQHGKPARISVTAPDSVLFQHLPASFIVGRYHSLFAQ
PQTIPSELKVIAISEDNVIMAIEHQTLPIAAVQFHPESIMTLAGEVGQTIIKNVVQTYTQ
TLGTSICS
Download sequence
Identical sequences A0A1W5CHN1 Q3M3E9
gi|75911086|ref|YP_325382.1| 240292.Ava_4890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]