SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 243265.plu4642 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243265.plu4642
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 4.19e-39
Family Frataxin-like 0.00000747
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 243265.plu4642
Sequence length 106
Comment (Photorhabdus luminescens)
Sequence
MNDSEFHQLADQLILYIEGQLDNYDGNADIDCETNGGVMTLSFDNDSKIIINRQEPFHQI
WLATKGGGYHFDYKEGQWICDRSGDNFLTMLAYAITEQSGEQFSFP
Download sequence
Identical sequences Q7MYN3
WP_011148713.1.100813 WP_011148713.1.49830 243265.plu4642 gi|37528459|ref|NP_931804.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]