SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 246197.MXAN_3531 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  246197.MXAN_3531
Domain Number 1 Region: 158-380
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 9.79e-55
Family D-glucarate dehydratase-like 0.00022
Further Details:      
 
Domain Number 2 Region: 1-142
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 8.49e-20
Family Enolase N-terminal domain-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 246197.MXAN_3531
Sequence length 386
Comment (Myxococcus xanthus DK 1622)
Sequence
MRIAQVSLIPLRLELRQPLKTSQGGHAVREGFLVRVVDEEGREGLGEAMPLPAFGTESLE
DCGVTLNAWLSELKGQFLGDSVRAIEDTLSPFPPAVARGDGVRIRARQVTPAGAMPAAEH
ALELALLDLLAQRQGVPLCWLLAEEARTEVAVNALLGADTPEALAGEARQAVAEGFGTLK
LKVAGRPLDADEARVKAVRDAVGPDVKLRLDANGGWSEPDAKRALDRLGWYGLELVEQPT
PPEDLAALWRVQRRAPCTVAADESLASPDALRALLTVDPLLGGGPAVGAVVLKPMVLGGL
LPCLVVAMRAARLGMQAYVTSSIDGVVARAGAAHLAAALPSGALASGLAIGRLLAKEPED
HPYHPQQGVIRLSSTPGLGLSSQSLV
Download sequence
Identical sequences Q1D6J8
WP_011553561.1.71322 WP_011553561.1.72039 WP_011553561.1.75941 WP_011553561.1.91991 246197.MXAN_3531 NYSGXRC-9739a gi|108761657|ref|YP_631725.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]