SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 251221.gll0641 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  251221.gll0641
Domain Number 1 Region: 71-399
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.57e-62
Family Integrin alpha N-terminal domain 0.0082
Further Details:      
 
Domain Number 2 Region: 407-483
Classification Level Classification E-value
Superfamily E set domains 4.76e-18
Family E-set domains of sugar-utilizing enzymes 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 251221.gll0641
Sequence length 485
Comment (Gloeobacter violaceus)
Sequence
MNASLPAGASSAACTPFQKVLPTILKMVCLRSQAVRLVGFGLAATVALSAAPVQAQVGFA
PAQTFGVGTTPRGLAIGDLDGDGRIDIVTANIGNNTLSALLGGGDGTFGDLQNYPVGSSP
RAATLADLNGDGDLDAITANGGSGNLSVLRGNGDGTFAAAVNYPVNGTFPAAVAAGDLDG
DGDLDLVSTNRYSENISLLSNNGNGTFGAPRNLVLPPGPSSVVIVDLDEDSDPDLVVGNL
FSANVSVLLNNGNGTFAAPRNYAAASGTSAVGMGDLDGDGDLDLTAVNRFADNVSVMLGN
GNGTFGATRNFAVGDYPVALAIGDLDENGDLDLVTANRRDAGNVSVLPGNGSGGFTAALT
FATGGDGATGVEAGDFDGDGDLDLAVANGFASNVGVLINTGDGVVLPVIDSITPRRGPVG
TEVTITGTGFTGTTAVTFGGASAAFTVISGTQITAIVPAGATSGPIAVTTPAGTATSARR
FRVTS
Download sequence
Identical sequences Q7NMX4
251221.gll0641 NP_923587.1.44878 gi|37520210|ref|NP_923587.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]