SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 251221.gll2870 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  251221.gll2870
Domain Number 1 Region: 74-127
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.0000107
Family GSPII protein E N-terminal domain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 251221.gll2870
Sequence length 131
Comment (Gloeobacter violaceus)
Sequence
MNPSGPDGRTHHDNSKFPNAAVPPSPPGVTHAPVSDGLSLAHPHPNRAPRPALDRYGADG
AERPRTLPHLLRPAMYPAIDDYLIGRGLVSERQLRRARELAQLWQGTVPVVLWKLGWIDL
NTFAVLLEYSS
Download sequence
Identical sequences Q7NCV6
251221.gll2870 NP_925816.1.44878 gi|37522439|ref|NP_925816.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]