SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 251221.glr1373 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  251221.glr1373
Domain Number 1 Region: 16-412
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.02e-130
Family Cystathionine synthase-like 0.00000000671
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 251221.glr1373
Sequence length 417
Comment (Gloeobacter violaceus)
Sequence
MTFTAQAHRTLTPAAVERLRADFPILRQTVYGKPLVYLDNAATTQKPQAVLDAIAALYTG
YYSNIHRGVHHLSQLSTEAHEQARIKVQQFINAQSDREIVFVRGCTEGINLVAQTFGRER
VGPGDEIVISAMEHHSNIVPWQMLCQEKGAILKVAPIDDRGEIILEAFEQLLGERTKLVA
VVHLSNALGTINPVARLIELAHTRGIPVLVDGAQAVSHIAVDVQALDCDFYVFSGHKLYA
PTGIGVLYGKAELLEAMSPWQGGGDMIRSVSFEKTIYSDLPYKFEAGTPDIAGAIALGVA
VDYVQHIGLEAIAGYEQELLDYATEALSAIDGVKLIGTARDKASVLSFVLAGVHPHDIGT
ILDRKGIAVRAGHHCAQPVMQRFKVPATARASFAFYNTRAEVDALVAAIQQVQEMFS
Download sequence
Identical sequences Q7NKV3
251221.glr1373 NP_924319.1.44878 gi|37520942|ref|NP_924319.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]