SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 251221.gsr2843 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  251221.gsr2843
Domain Number - Region: 15-60
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.000243
Family GSPII protein E N-terminal domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 251221.gsr2843
Sequence length 63
Comment (Gloeobacter violaceus)
Sequence
MPEAIQMTHQLAAENYLLHHRLITGAQLERARRLALLWQGDLPIVLWKIGLIDLATLASL
IDL
Download sequence
Identical sequences Q7NCY3
NP_925789.1.44878 gi|37522412|ref|NP_925789.1| 251221.gsr2843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]