SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 251221.gvip059 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  251221.gvip059
Domain Number 1 Region: 13-397
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.88e-127
Family GABA-aminotransferase-like 0.000000194
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 251221.gvip059
Sequence length 404
Comment (Gloeobacter violaceus)
Sequence
MVAVMTVQQAFEQHVMHTYARFSVVFERGEGCYLEDSEGRRYLDFVAGIATCVLGHAHPV
LSAAVAEQARTLIHVSNLYYTPQQACLAEWLTAHSAADQVFFCNSGAEANEGAIKLARKY
GRTVLGIAEPQIICAHQSFHGRTMATVTATGQPKYQKHFHPLVPGFVHVPYNDFEALRAQ
VTDATAAVLIEPIQGEGGVVPGDVEFFQKLRRFCSERRILLMLDEVQTGMGRTGRLFGYE
HLGIEPDVFTLAKALGGGVPIGALCAKEAFAIFEPGDHASTFGGNPLACAAALAVCQTLE
AEQLVDNARERGAQLAAGLGRLVERFKPLVRTARGRGLMQGLVLSEPRAAEIVRLAMEQG
LLLVSAGPEVIRFVPPLIVSAIEVDEALAILEGVFARLPVTVTA
Download sequence
Identical sequences 251221.gvip059 NP_923493.1.44878 gi|37520116|ref|NP_923493.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]