SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 251221.gvip383 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  251221.gvip383
Domain Number 1 Region: 2-116
Classification Level Classification E-value
Superfamily Ribosomal protein L20 2.09e-48
Family Ribosomal protein L20 0.0000332
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 251221.gvip383
Sequence length 119
Comment (Gloeobacter violaceus)
Sequence
MVRVKRGNVARKRRKKILKLAKGFRGSHSKLFTAANQQVMKALRNAYRHRRTKKRDFRSL
WIVRINAQARTEGLSYSRLIDGLHKADVALNRKMLAQLAVTDPEAFAEVARVAKSARPV
Download sequence
Identical sequences Q7NGV3
251221.gvip383 gi|37522353|ref|NP_925730.1| NP_925730.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]