SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 251221.gvip419 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  251221.gvip419
Domain Number 1 Region: 5-63
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 2.11e-19
Family Ribosomal protein L33p 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 251221.gvip419
Sequence length 63
Comment (Gloeobacter violaceus)
Sequence
MAKPGARIIITLECTECRTNTAKRRPGVSRYTTTKNKRNTTGRMELKKFCPNCNKHTVHK
ETK
Download sequence
Identical sequences Q7NCB9
NP_926006.1.44878 251221.gvip419 gi|37522629|ref|NP_926006.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]