SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 251221.gvip571 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  251221.gvip571
Domain Number 1 Region: 38-309
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.71e-75
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000148
Further Details:      
 
Domain Number 2 Region: 299-400
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.00000000000000262
Family Tyrosyl-tRNA synthetase (TyrRS), C-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 251221.gvip571
Sequence length 402
Comment (Gloeobacter violaceus)
Sequence
MDERQVERLSGHGVAEIFPGGAEALTRRLADAETARMPLRVKLGIDPTRPDLHLGHTVVL
RKLREFQDLGHTAILLIGGFTAQIGDPTGKSEARPRLSAAEVEEYAETYLDQARLILNFD
TLEVRNNTEWLSGLDLAAIIKLLASTSVAQMLAKEDFGQRYEAGTAIYLHEFLYPLMQGY
DSVALDADIELGGTDQRFNLLMGRNLQELFGKKPQLALTVPLLVGLDGVKKMSKSLDNYV
GVTEDPLTMYSKLEKTPDALVETYFELLTDLSVSALSANPRERQKRLALAVTGWLHSPEQ
ALRAQEAAAAMVTGSGGTGADLEAVPEFSLTEIAFPVRLANLLKAAGLCPTVSEGMRQIK
NGAVRLNQERITDPNCGFAEAAELTGAVLQVGKKHFRRLVPS
Download sequence
Identical sequences Q7ND21
NP_927361.1.44878 gi|37523984|ref|NP_927361.1| 251221.gvip571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]