SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 257314.LJ0385 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  257314.LJ0385
Domain Number - Region: 144-226
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.016
Family Capz alpha-1 subunit 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 257314.LJ0385
Sequence length 502
Comment (Lactobacillus johnsonii NCC 533)
Sequence
MKYFIPAWHKQYDDWSINIPSIENYDAAEYMTVLKKFDEEIGLIITDYQSQLLSKLNQIA
FFPNTLFSVYDFLQGVHGFENKVLELEDFNWPKNAIFDYGPFRTLIVLENKLYATVFYDI
DGHILRISYPENDEHKAFTLGIDSRGFISNQDDEEKTIYFDPYGNWRFKKDKTTDKITVN
PEMHFCKRREYENITDLVDEILSRYLKVNAKNNDEIIVTVDDESSFNNEIIEPYKPLYII
NRHHPYSKKIGSLARAKVIVSSNEIKQNLEKNYREQFDISVIPVFNSEFRLGHSQRQNVQ
EIGFFAENANDENIHQIIQKLCNYILKNPDNYSLKIFTYNFWKADHVNKILEQIKEENKN
SFILGKSEQAENAPIDGLDDEVSLPELDVAHTRLTNISDVLSNLDKMRLLINWGKADELM
QISGVSIGIPQVQNFSSVTVVDNKNGRIIKKISELLPVVDEYLTNLNSWNQTVVYNVQLM
NQYSEENIIEKWKEVFKERKAE
Download sequence
Identical sequences Q74L40
WP_011161544.1.27409 257314.LJ0385 gi|42518479|ref|NP_964409.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]