SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 259564.Mbur_2155 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  259564.Mbur_2155
Domain Number 1 Region: 1-179
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 4.97e-55
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 259564.Mbur_2155
Sequence length 180
Comment (Methanococcoides burtonii DSM 6242)
Sequence
MKEIRIHGRGGQGSVTAAELLAVAAFADGKFSQAFPAFGVERRGAPVQAFTRINDDPIRL
RAQVYEPDYVIVQDPTLLEVVDVESGAKDDGVILINSDFEPEHFDLNTNAKIMTVNATKI
ALDIIGRPIVNTVLLGAFAGASGLIDPESIKNAVKERFPGKIGEKNAEAIQKAYDMMTEA
Download sequence
Identical sequences Q12U51
WP_011500163.1.71292 gi|91774083|ref|YP_566775.1| 259564.Mbur_2155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]