SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 262316.MAP3232 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  262316.MAP3232
Domain Number 1 Region: 19-199
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.18e-44
Family Methylesterase CheB, C-terminal domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 262316.MAP3232
Sequence length 309
Comment (Mycobacterium avium paratuberculosis)
Sequence
MRRRVETERVTTEADRPGVELVALVASAGGLEALTTVLRDLPRDFPAAVVVQQHLAGHDS
LLATILTRQSGRPVGWAANGRAVTPGEVVICPPGKALELTPQGRCRLHGAQQHGARGADV
LLTSIAGSYGPRGVAVVLSGSGRDGAAGTVAMRRAGGVVIAESPATALYPSMPIAAAQAG
ADLVLGIGEIAPVLADLVHGLPLPRRSPPADAPDEAYLDGGVDPDGIFARLAARFGANTP
AARAELARLRAAELRRRRQELSAGVGATRETVATARRRAEESRRRALLAHRAADEAWARS
EQEHRDRDG
Download sequence
Identical sequences Q73UY4 V7KY78
262316.MAP3232 gi|41409330|ref|NP_962166.1| gi|499074950|ref|YP_007970428.1| WP_003874789.1.101064 WP_003874789.1.1614 WP_003874789.1.26008 WP_003874789.1.29527 WP_003874789.1.3468 WP_003874789.1.35606 WP_003874789.1.45459 WP_003874789.1.45501 WP_003874789.1.59922 WP_003874789.1.646 WP_003874789.1.66905 WP_003874789.1.76287 WP_003874789.1.8174 WP_003874789.1.83216 WP_003874789.1.89157 WP_003874789.1.9350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]