SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 262543.Exig_1248 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  262543.Exig_1248
Domain Number 1 Region: 11-142
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.92e-24
Family Voltage-gated potassium channels 0.0011
Further Details:      
 
Domain Number 2 Region: 122-250
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.00000000000000719
Family Potassium channel NAD-binding domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 262543.Exig_1248
Sequence length 339
Comment (Exiguobacterium sibiricum 255 15)
Sequence
MFGKDEKSMVWLRFLRRMSFLRMRTLAYASFLFVFGVALIMYLAEPDTFGTYFRAVYWTM
TTVVTVGYGDFFPNTDFGRFMTIFVFIFGIGIVGGLISKLVDGVQLIRNQKERGLLQVKE
TGHTLVFGYSRRSKHVIDELLETTDVILIDDLEREPFSHPRFHYVSGDPALDATLQRANI
KKATRAIVLADHSIPPALADGRTLLIAASIERANPNIYTIVEMMLEEHLDSFEQVKVDEV
LLGDETVARMAILAAYHPGVSKVVTNLLTKDGDGMFSLPAKPEWQTFRDAFHILLEDGVT
ILSDGKRLDLNRRLNEPIPPNTTLIVLCSEETAQRIGAV
Download sequence
Identical sequences B1YEW8
262543.Exig_1248 WP_012370147.1.68707 gi|172057283|ref|YP_001813743.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]