SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 262724.TTC0817 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  262724.TTC0817
Domain Number 1 Region: 389-514
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.19e-21
Family Histidine kinase 0.016
Further Details:      
 
Domain Number 2 Region: 180-326
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000000294
Family GAF domain 0.0078
Further Details:      
 
Weak hits

Sequence:  262724.TTC0817
Domain Number - Region: 327-401
Classification Level Classification E-value
Superfamily AF1862-like 0.0693
Family Cas Cmr5-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 262724.TTC0817
Sequence length 515
Comment (Thermus thermophilus HB27)
Sequence
MTEHSLYRLVRLAQRLLPPAIALVVLAFELALSPFDHTSALFWLRLGFYGLVGPLVTYAV
LEWIAQEVLEKARAERALEEANRRLLASERVFREALASENLEEAVLRIARGLEETLGYPV
ALEAEGVRSGKGCGGRRVALPGLKGYLEACGDGTDQVFLEVLAHEVAGALQAVVARSRDL
LTLFEVDQALKAEANLDRLLEGLLDRIRAWAGAEGGGVLLLDEEGFLLARVVQGLALPSH
PFLPEGAWKAALQGPVFVEKGVLALPLKAREPVGVLVLKGEDLSRRIPFLSFLASQVALA
VRNAQAYLKAEELAINEERTRIAREIHDGLAQSLAFMALKLDLVERLWEKDKGAALGALA
EVRETLRAQIREVRRSIFALRPIDLERYGFLESLRRYAQAFAEQAGFRVQLSLPERVGLS
QASELVLFRVLQEALTNAAKHARPTRVEVVLEPLGERGARLVVRDNGRGFAVPEAQGLGG
FGLTQMRERVEARGGRFWVVSAPGRGTEVGAEVPY
Download sequence
Identical sequences Q72JF5
262724.TTC0817 gi|46199123|ref|YP_004790.1| WP_011173249.1.85415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]