SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 263820.PTO1356 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  263820.PTO1356
Domain Number 1 Region: 196-307
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.0000000000000352
Family Homoserine kinase 0.052
Further Details:      
 
Domain Number 2 Region: 6-171
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.000000000000114
Family GHMP Kinase, N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 263820.PTO1356
Sequence length 324
Comment (Picrophilus torridus DSM 9790)
Sequence
MENYNVKTRAFPTIGIILLGGISDKKNRIPLHTTAGIAYTGINNDVYTETKLYVSKDEKC
YIDGKEIDLNSDRSPSKVIDKFKHEILMRVNLDDENNLSIDSRNFNILSGSSDSGAAALG
ECIESIFEYNINIFTFENDLQRISESVGRSLYGGLTVNYANGRESLTEPLLEPEAFNNFT
IIGAHFNIDRKPSNEIHENIIKHENYRERIKSAERKAKKLEELSRNANIKGIFELAESDT
VEYHKMLHDVGVDIINDRMENLIERVKEMKNNFWNSYIVTGGPNVFVITEKKDVDKAMEG
LNDLCDDIRLLKVAGKPQVISKNF
Download sequence
Identical sequences Q6KZB1
WP_011178157.1.10384 263820.PTO1356 gi|48478428|ref|YP_024134.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]