SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 264198.Reut_A0607 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  264198.Reut_A0607
Domain Number 1 Region: 3-185
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 8.37e-47
Family Methylesterase CheB, C-terminal domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 264198.Reut_A0607
Sequence length 328
Comment (Ralstonia eutropha JMP134)
Sequence
MTRNVVTIGGSRGAFTVLRDVVAALPAALDAAVFIVLHVGKHKSELPSLLTRWGKLPASY
PQHGDVWKPGHIYVAPPDHHMLITADTIHLSHAAKENFSRPAIDPLLRSAAVALGSRVIG
VILSGDLDDGAAGLAFVRAFGGRTLIQNPRDAEATSMPKSAMEAAGADLMASPAELGHAI
VALLQASGEGEFDPKREKDMQALRSEAATADNPAGSAFEELDSIAARAAITCPECGGAMW
QLRDTHPLRFRCHTGHAFSGMTLTAAEDKATEHAMWTAVRAQKEALALARIRAAHAKSDG
NRDAYQIELSRIQQCERLLKVLQGAIAE
Download sequence
Identical sequences Q475E4
WP_011296795.1.84135 gi|73540313|ref|YP_294833.1| 264198.Reut_A0607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]