SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 264198.Reut_A2696 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  264198.Reut_A2696
Domain Number 1 Region: 120-287
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 8.24e-46
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00066
Further Details:      
 
Domain Number 2 Region: 410-553
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.53e-41
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00052
Further Details:      
 
Domain Number 3 Region: 1-126
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.29e-32
Family Duplicated SiR/NiR-like domains 1 and 3 0.011
Further Details:      
 
Domain Number 4 Region: 252-276,315-422
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.11e-26
Family Duplicated SiR/NiR-like domains 1 and 3 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 264198.Reut_A2696
Sequence length 560
Comment (Ralstonia eutropha JMP134)
Sequence
MYQYDQYDQRIVNERVAQFRDQVRRRLSDELTEEEFLPLRLQNGLYMQRHAYMLRVAIPY
GLLASKQLRKLAHIAREYDRGYGHFSTRQNIQYNWMELERVPDVLAELASVEMHGIQTSG
NCVRNITTDHFAGVAPDESVDPRVLAELLRQWSTFQPEFAFLPRKFKIAISASKDDRAVV
QMHDIGIYVYKNDAGETRIRVLAGGGLGRTPILGTIIKDDLPWQHMLTYVESAIRVYNRY
GRRDNKYKARIKILVKAIGAEKFAEEVEEEWQYSKDGPGTLTQDEFDRVAQYFTPPAYEK
LADTDASYEKHLLEDKAFARWVSRSVHGHKVPGYAAVTLSTKPGPVSPPGDATAEQMEAV
ADLADQFGFGELRVAHEQNLVLPDVKKHDLYDLWQLAKKAGLATANIGLLTDIIACPGGD
FCSLANAKSIPIALAIQERFDNLDFVHDLGEVSLNISGCINACGHHHVGNIGILGVDKDG
SEWYQVTLGGAQGNSTALGKVIGPSFSAEEMPDVISRIIETFVANRIEDERFIETVNRIG
IAPFKERVYADKQPRERAEA
Download sequence
Identical sequences Q46XS6
264198.Reut_A2696 WP_011298844.1.84135 gi|73542381|ref|YP_296901.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]