SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 264198.Reut_B4971 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  264198.Reut_B4971
Domain Number 1 Region: 2-113
Classification Level Classification E-value
Superfamily SpoIIaa-like 6.47e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 264198.Reut_B4971
Sequence length 119
Comment (Ralstonia eutropha JMP134)
Sequence
MERIPILRMGKHLLVTIQIDMQDQTALMLQEDLAGQIEKSGAHGVLIDVSALEVVDSFIG
RMLVSISDIGRLLGATTVVVGIRPAVAITLVELGLSLGGVRTALNVERGMAILDGVRRN
Download sequence
Identical sequences Q46RB5
WP_011301085.1.84135 264198.Reut_B4971 gi|73538796|ref|YP_299163.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]