SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 264730.PSPPH_3451 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  264730.PSPPH_3451
Domain Number 1 Region: 5-173
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 7.22e-31
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 264730.PSPPH_3451
Sequence length 181
Comment (Pseudomonas syringae phaseolicola 1448A)
Sequence
MNRVSLRLWDSLVRLFHISIAGVFVANYFFNEAGDDWHVWLGYYAVAWLAVRVVWGFIGP
ASARWSDFWPSPTRLRAHVRSLINRQPVHRLGHSPLGALVMVLMMALIFGMGLTGFLMEE
VDALWGADWPLQAHEILANTLCALVVLHMAAAIFESFQVRDNLPLSMLTGKRRPLPEDRH
R
Download sequence
Identical sequences A0A0N0W9E5 A0A0N8SF32 A0A1E3XTT0 Q48G76
WP_011169122.1.10739 WP_011169122.1.12791 WP_011169122.1.27185 WP_011169122.1.28195 WP_011169122.1.70455 WP_011169122.1.86037 264730.PSPPH_3451 gi|71733490|ref|YP_275607.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]