SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 265311.Mfl066 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  265311.Mfl066
Domain Number 1 Region: 127-227
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00000000000085
Family Intein endonuclease 0.057
Further Details:      
 
Weak hits

Sequence:  265311.Mfl066
Domain Number - Region: 24-177
Classification Level Classification E-value
Superfamily HAD-like 0.0783
Family Predicted hydrolases Cof 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 265311.Mfl066
Sequence length 317
Comment (Mesoplasma florum L1)
Sequence
MSFALTVKEEVISHTFDDNLGQAFLAGFIKYNGDFIWGSGTEKLKLTSISNKIARSIFGL
CKKMFDGHIEISVSQTQTLKQNKTYQITLIGKISEFLRELNIWNENNTKIVEFKPLKQEK
NKDELIKLKRAYMAGVFVSVGSVNSPETTNYHLELQFKDEESALYIIKLMNKYGFDFKIL
KRNDKLFICYIKKAIMVSDFLKFIDAYQAVMNFENERIMRDVSNNVNRVNNIDISNEKKT
LSAGLKQIDQISKIQANLATKRLSEKAAYLCDLRIQNPNASYADLTELMNEFGYEITKSG
VSNLFKIIEKLSLEFNN
Download sequence
Identical sequences A0A291MS21 Q6F251
gi|50364881|ref|YP_053306.1| YP_053306.1.45369 265311.Mfl066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]