SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 266117.Rxyl_0260 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266117.Rxyl_0260
Domain Number 1 Region: 5-135
Classification Level Classification E-value
Superfamily AF1862-like 3.66e-35
Family Cas Cmr5-like 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 266117.Rxyl_0260
Sequence length 141
Comment (Rubrobacter xylanophilus DSM 9941)
Sequence
MAEERTLEQRRAAHALAAIQELQRAGRGGYGNYKSYVSSLPATILTNGLGQAAATLLAGA
KLNSKNRNADNRAREKLYDHLSSWLCGGDEESPYQKKGDLLENITRNDQDCYIRAQAEAL
EYLSWLKRFAEAFLEGSKGEK
Download sequence
Identical sequences Q1AZE1
266117.Rxyl_0260 gi|108803112|ref|YP_643049.1| WP_011563255.1.70533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]