SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 266117.Rxyl_1571 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266117.Rxyl_1571
Domain Number 1 Region: 2-304
Classification Level Classification E-value
Superfamily Aldolase 1.3e-53
Family HMGL-like 0.0000607
Further Details:      
 
Domain Number 2 Region: 301-440
Classification Level Classification E-value
Superfamily post-HMGL domain-like 5.1e-32
Family Conserved carboxylase domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 266117.Rxyl_1571
Sequence length 492
Comment (Rubrobacter xylanophilus DSM 9941)
Sequence
MSGSVDIVDTTLRDGNQSLWSATGLTTQDVLAIAPTMDRVGFHALDFTSSTHMGISVRFH
REDPWERIRLVSAAMPNTPLGLITTGMRFIRWVPAGEDLMRLAFRCWVRNGMRRIQIVDP
SNDPGALLRMARIAREEGFEEVVVGLTYSISPVHTHEYYLERAAAAARSEDIDRLYLKDP
GGLLTPDAVRALIPGFIERFAPRPVELHSHCTIGLGPLAYVEGLRSGVRILHTAVEPLGS
GSSNPPAGATLRNIEAEGLSCDLDTEALGVVSDYFHELARERGLPPGTPREFDGAYFRHQ
MPGGMISTTRRQLQELGRPELFDAVLEEVPRVRAEMGYPIMVTPVSQFVATQAVMNVISG
ERWSKVSDEMVRYFLGHYYDPPAPVDADVADRVLSMPRADELKHLKPITLEGARERFGRR
LSDEELLLRLTMPAEQVDAMVAERGRQRAPLVRPGRAPLVRLLHELSKRKSISYLKLEDE
RTGDTIVWRHGS
Download sequence
Identical sequences Q1AVP5
266117.Rxyl_1571 WP_011564550.1.70533 gi|108804408|ref|YP_644345.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]