SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266264.Rmet_1109 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266264.Rmet_1109
Domain Number 1 Region: 1-120
Classification Level Classification E-value
Superfamily SpoIIaa-like 8.24e-29
Family Sfri0576-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 266264.Rmet_1109
Sequence length 122
Comment (Ralstonia metallidurans CH34)
Sequence
MMEILDGFPANVVAVHGNGKLTRDDYEKVLIPAIDAVLTGREKVRLYYELGPDFTITSME
PGALWDDFKLGVSHYLKWESVVVVTDHDWVRHSINVFRFLVPGQIRTFPMSQSREAREWI
VG
Download sequence
Identical sequences Q1LPD1
gi|94310054|ref|YP_583264.1| WP_011515896.1.12480 WP_011515896.1.25839 266264.Rmet_1109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]