SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 266265.Bxe_A2214 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266265.Bxe_A2214
Domain Number 1 Region: 644-820
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 7.72e-49
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0023
Further Details:      
 
Domain Number 2 Region: 16-200
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.17e-40
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0031
Further Details:      
 
Domain Number 3 Region: 162-319
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.74e-26
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0063
Further Details:      
 
Domain Number 4 Region: 514-652
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 5.72e-25
Family Duplicated SiR/NiR-like domains 1 and 3 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 266265.Bxe_A2214
Sequence length 862
Comment (Burkholderia xenovorans LB400)
Sequence
MPQDGARNQHIEETALMKIIVIGHGMVGHKLVECLAEDAAHGLDITVLCEESRPAYDRVH
LSEFFAGKTADDLSLVEPGFFERRNVLLKLNAKAVAIDRDARTVTVSTGETLPYDKLVFA
TGSYPFVPPVQGRERTDCFVYRTIDDLEAMRECGARSKTGTVVGGGLLGLECAKALRDMG
LQTHVVEFAPRLMAVQVDDGGGRVLRTKIEELGVTVHTQKNTTAIVDGEAGTHRMQFADG
SHLDTDMIVFSAGIRPRDDLARESGLTLGARGGIVIDNACRTSDPHIYAIGECALWNGQL
FGLVAPGYEMARAVAKQLLGGAAEFAGADMSTKLKLMGVDVASIGDAHGSTPGSRAYQFS
DERKQVYKKLVVSECGKYLLGGVMVGDAGEYGALLQMMLNRIELPASPEFLILPQADGNA
KPALGVEALPAGAQICSCNNVSKGELCAAVCAGATDIGALKGATGAGTSCGGCVPLVTQV
MKAEMKKQGLAVNNHVCEHFPYSRQELYHIVRVEGVRSFGALLAKHGHGLGCDICKPLVA
SILASCWNEFVLKKEHASLQDTNDYYLANIQRDGTYSVVPRMAGGEVTPDGLIAVGQVAK
KYGLYTKITGGQRVDLFGARVEQLPLIWEELIAAGFESGHAYGKSLRTVKSCVGSTWCRY
GVGDSVGLAVEMENRYKGLRTPHKIKFGVSGCTRECAEAQGKDVGIIATEKGWNLYVCGN
GGMKPRHAELLASDLDKETLVRYIDRFLMFYVRTADRLQRTSVWRDNLEGGLEYLIDVVV
NDRLGVAGELESEMQHVVDTYECEWKKAVTDLETRKRFRHFVNSGESDSNLAFVEERGQI
RPATPAERRSKLAAIPVVAETV
Download sequence
Identical sequences Q13YT4
266265.Bxe_A2214 gi|91783601|ref|YP_558807.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]