SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 266834.SMc01556 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  266834.SMc01556
Domain Number - Region: 190-252
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 0.0965
Family D-glucarate dehydratase-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 266834.SMc01556
Sequence length 262
Comment (Sinorhizobium meliloti)
Sequence
MFSTRIARTVHVAAVAAAFAGAFAAAAAAQESTAGKGDGKGRPDGVRGRQAVIKVSGEGR
STTAPDMAILQLSVVKDAKTAREALDANNKAMADVLSALKQAGIAERDLQTSGFSINPQY
HYPPNNDGGNRPPELVGYQVVNGVGVRVRDLGQLGEILDKSVTLGVNQGGGIEFTNDKPD
AVITEARKAAVADAINKAKVLAEAAGVSLGRVIEIAEQPSRPEPIPVVRSMAKEFAAADS
VPMATGENAYNVTVNVTFAVNQ
Download sequence
Identical sequences A0A0E0UF31 A0A222KRF2 F7X1Y8 H0GBE2 Q92NA6
RmR69 gi|384530193|ref|YP_005714281.1| 266834.SMc01556 gi|384535328|ref|YP_005719413.1| gi|15966060|ref|NP_386413.1| gi|334317065|ref|YP_004549684.1| gi|470189273|ref|YP_007575584.1| NP_386413.1.96377 WP_003537551.1.18618 WP_003537551.1.21755 WP_003537551.1.22199 WP_003537551.1.24285 WP_003537551.1.30341 WP_003537551.1.3110 WP_003537551.1.32135 WP_003537551.1.36091 WP_003537551.1.36292 WP_003537551.1.36834 WP_003537551.1.4234 WP_003537551.1.44594 WP_003537551.1.48083 WP_003537551.1.50755 WP_003537551.1.54190 WP_003537551.1.55094 WP_003537551.1.58221 WP_003537551.1.58608 WP_003537551.1.63001 WP_003537551.1.66997 WP_003537551.1.72343 WP_003537551.1.73540 WP_003537551.1.78492 WP_003537551.1.787 WP_003537551.1.83096 WP_003537551.1.86220 WP_003537551.1.90561 WP_003537551.1.92524 WP_003537551.1.94084 WP_003537551.1.99158 gi|433614133|ref|YP_007190931.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]