SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 266835.mll6698 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266835.mll6698
Domain Number 1 Region: 41-109
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000216
Family Anti-sigma factor antagonist SpoIIaa 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 266835.mll6698
Sequence length 118
Comment (Mesorhizobium loti)
Sequence
MRRSQAMEIKTDDYRVWIEGSDIFFDGVMRLASSEAGAPIMALATSALASNPSSMTLNLK
DLHFLNSSGINLLAKFTIEVRKHPDVRFVVRGTPDIPWQSKSLPNLKKLHPALVLLMD
Download sequence
Identical sequences Q988K6
266835.mll6698 gi|13475591|ref|NP_107155.1| 392906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]